PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000419.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 256aa    MW: 28666.3 Da    PI: 8.839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000419.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLk kv + +l++ ++i+evdi+k++PwdLp      e+e yfFs+r+ ky++g+r+nrat+sgyWkat
  Itr_sc000419.1_g00006.1  14 LPPGFRFHPTDEELVVQYLKCKVLSCPLPA-SIIPEVDICKSDPWDLPGD---LEQERYFFSTREVKYPNGNRSNRATSSGYWKAT 95 
                              79****************************.89***************54...46799**************************** PP

                      NAM  87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk+++s+  +++lvg+kktLvfykg+ p+g +tdW+mheyrl
  Itr_sc000419.1_g00006.1  96 GLDKQIVSSkgHRQLVGMKKTLVFYKGKPPQGARTDWIMHEYRL 139
                              ********9777778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-619162IPR003441NAC domain
PROSITE profilePS5100558.10814162IPR003441NAC domain
PfamPF023655.0E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEKLSFVKNG VLRLPPGFRF HPTDEELVVQ YLKCKVLSCP LPASIIPEVD ICKSDPWDLP  60
GDLEQERYFF STREVKYPNG NRSNRATSSG YWKATGLDKQ IVSSKGHRQL VGMKKTLVFY  120
KGKPPQGART DWIMHEYRLT NAESLPNNPP QENWVLCRIF LKKRGAKNED ENTPAQAQTP  180
TQAQAVTNNR GAGLKNNGKP VFYDFLARER TDLNLAPASS SSGSSGVTEA SCNDKTDDHE  240
ESSSCCNSFT TFRTKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521216715170NO APICAL MERISTEM PROTEIN
1ut4_B2e-521216715170NO APICAL MERISTEM PROTEIN
1ut7_A2e-521216715170NO APICAL MERISTEM PROTEIN
1ut7_B2e-521216715170NO APICAL MERISTEM PROTEIN
4dul_A2e-521216715170NAC domain-containing protein 19
4dul_B2e-521216715170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881782.11e-130PREDICTED: NAC domain-containing protein 83-like
RefseqXP_015902286.11e-130PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY931e-100NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0M4FP121e-130A0A0M4FP12_MANES; NAC transcription factors 34
STRINGPOPTR_0001s13380.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13872377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-98NAC domain containing protein 83